PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000708m
Common NameCARUB_v10000708mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family EIL
Protein Properties Length: 525aa    MW: 59614 Da    PI: 6.5085
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000708mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3382.94.9e-117494121354
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                      eel+kr w+d+++lk l+e+ k+ ++++   ++++  ++  ++++++++ +aQDgiLkYM k+m  c+aqGfvYgi+ e+gk+v g+sd+Lr+W
  Carubv10000708m  49 EELEKRIWRDKQRLKYLREMAKSGVGKR---FSNQLDDEFLQHSSKRTIYKAQDGILKYMSKTMDRCKAQGFVYGIVLENGKTVAGSSDNLREW 139
                      8*********************987443...56777889******************************************************* PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--T CS
             EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglsk 188
                      Wk+kv+fdrngpaai+k+ ++ + +++++  +  ++s+ h+l elqDTtlg+LLsalm  c+ppqrrfpl+kgv+pPWWPtGke+ww++l+l+ 
  Carubv10000708m 140 WKDKVRFDRNGPAAITKHHKDSNPFDSSEIGSEVGESTAHKLLELQDTTLGALLSALMPNCKPPQRRFPLDKGVTPPWWPTGKEDWWSQLSLPD 233
                      ******************6666655555555455************************************************************ PP

                      T--...-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX.........XXX CS
             EIN3 189 dqg..tppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss.........slr 268
                      d +  +ppykkphdlkk wkv+vL avi+hm+ +i++i +l+r+s++lq+km+++e + +l+ lnqe++++++++ +   s             
  Carubv10000708m 234 DCRglPPPYKKPHDLKKLWKVGVLIAVIRHMASDISNIPNLVRRSRSLQEKMTSREGALWLAALNQEKAIVDQMHHSftfSTennnncnfpVPG 327
                      **************************************************************************99966522666777665334 PP

                      XXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
             EIN3 269 kqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                      +++++v + +++++dveg   s+  + q  +  +++++v krk + +  ++++ + +  tc++s +++s+++++f d+n ++++++
  Carubv10000708m 328 TGDTDVLFPESANYDVEGIGGSHRFSPQYPEVDNTYTCVYKRKFEGDLGMSMH-QPTLLTCENSLCPYSQPHMGFYDRNLRENHQM 412
                      5999*************888888888999999999********7666666665.5578**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.4E-11049301No hitNo description
Gene3DG3DSA:1.10.3180.106.6E-62173310IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.05E-53178304IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MDMYNNNRGL FRGLVCSPVV PPFSEGDACS DAHTALFNDM SSDEEMDIEE LEKRIWRDKQ  60
RLKYLREMAK SGVGKRFSNQ LDDEFLQHSS KRTIYKAQDG ILKYMSKTMD RCKAQGFVYG  120
IVLENGKTVA GSSDNLREWW KDKVRFDRNG PAAITKHHKD SNPFDSSEIG SEVGESTAHK  180
LLELQDTTLG ALLSALMPNC KPPQRRFPLD KGVTPPWWPT GKEDWWSQLS LPDDCRGLPP  240
PYKKPHDLKK LWKVGVLIAV IRHMASDISN IPNLVRRSRS LQEKMTSREG ALWLAALNQE  300
KAIVDQMHHS FTFSTENNNN CNFPVPGTGD TDVLFPESAN YDVEGIGGSH RFSPQYPEVD  360
NTYTCVYKRK FEGDLGMSMH QPTLLTCENS LCPYSQPHMG FYDRNLRENH QMNCPYKVTS  420
FYQPAKHFGM SGLMAPCPDY NRMQQQVQSI QDQFNPPNNP YRPKAEQRGD SYNDLVDDQS  480
PSPSMVNHNP GLVLPTDFND HAETVGMENN LQNQGQGLPT SWMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-551763081131Protein ETHYLENE INSENSITIVE 3
4zds_B4e-551763081131Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287498.10.0hypothetical protein CARUB_v10000708mg
SwissprotO231150.0EIL2_ARATH; ETHYLENE INSENSITIVE 3-like 2 protein
TrEMBLR0FER20.0R0FER2_9BRAS; Uncharacterized protein
STRINGAT5G21120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147191621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G21120.10.0ETHYLENE-INSENSITIVE3-like 2